| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK479950.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
| QAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTT GQKNKITITNDKGRLSKEEIENMVQEAEK | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,209.164 | ||
| Theoretical pI: | 4.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 21.195 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.255 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK479950.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
| QAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTT GQKNKITITNDKGRLSKEEIENMVQEAEK | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,209.164 | ||
| Theoretical pI: | 4.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 21.195 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.255 | ||
| sheet | 0.248 | ||