| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK479962.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
| QIYRDSPNQWRILEWKQSQDLLSGELKTSALALTKNPTPLRSVSGTGTCLSRRIVICIYVCFQSHLVYQKNNRLLQDSLFVSLMLEQIADFTSLQFMRDYFGHAKTFVWYVDSTFMVAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,149.987 | ||
| Theoretical pI: | 9.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 56.027 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.467 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.243 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK479962.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
| TNLQRFTESMADSRVETISRLAQWRIENFGPCSYKKSDPFKVGIWNWHLSVEKNRYLYIRLFPEPSRLSKEQPPIARFVVRVSNAGTNRRLYISPVHERLLRSCEDFCLVC* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 13,149.987 | ||
| Theoretical pI: | 9.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 56.027 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.467 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.243 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK479962.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
| QIYRDSPNQWRILEWKQSQDLLSGELKTSALALTKNPTPLRSVSGTGTCLSRRIVICIYVCFQSHLVYQKNNRLLQDSLFVSLMLEQIADFTSLQFMRDYFGHAKTFVWYVDSTFMVAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,149.987 | ||
| Theoretical pI: | 9.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 56.027 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.467 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.243 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK479962.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
| TNLQRFTESMADSRVETISRLAQWRIENFGPCSYKKSDPFKVGIWNWHLSVEKNRYLYIRLFPEPSRLSKEQPPIARFVVRVSNAGTNRRLYISPVHERLLRSCEDFCLVC* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 13,149.987 | ||
| Theoretical pI: | 9.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 56.027 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.467 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.243 | ||
| sheet | 0.207 | ||