Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK479987.1 | 5prime_partial | 164 | 1-495(+) |
Amino Acid sequence : | |||
TNLQRFTESMADSRVETISRLAQWRIENFGPCSYKKSDPFKVGIWNWHLSVEKNRYLYIRLFPEPSRLSKEQPPIARFVVRVSNAGTNRRLYISPVHERLLRSCEDFVWYVDSTFHGRFI VDVEFLDLKICPLNGGEANSIWPSDGMMQSISGPQHTSMPFSHA* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 13,617.698 | ||
Theoretical pI: | 9.185 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 45.136 | ||
aromaticity | 0.101 | ||
GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.227 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK479987.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
QIYRDSPNQWRILEWKQSQDLLSGELKTSALALTKNPTPLRSVSGTGTCLSRRIVICIYVCFQSHLVYQKNNRLLQDSLFVSLMLEQIADFTSLQFMRDYFGHAKTLSGMLIPPFMVAS* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,617.698 | ||
Theoretical pI: | 9.185 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 45.136 | ||
aromaticity | 0.101 | ||
GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.227 | ||
sheet | 0.244 |