| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK480001.1 | internal | 100 | 3-302(+) |
Amino Acid sequence : | |||
| LIQSGPPRFQEKAEFLLQCLPGTLVVVIKRGNNMKQSVGNPSVYCKLTLGNSPPRQTKVVSTGPNPEWDGSFAWTFESPPKGQKLHISCKNKIKMGKNSF | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,043.719 | ||
| Theoretical pI: | 9.900 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 50.615 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.493 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.350 | ||
| sheet | 0.160 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK480001.1 | internal | 100 | 3-302(+) |
Amino Acid sequence : | |||
| LIQSGPPRFQEKAEFLLQCLPGTLVVVIKRGNNMKQSVGNPSVYCKLTLGNSPPRQTKVVSTGPNPEWDGSFAWTFESPPKGQKLHISCKNKIKMGKNSF | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,043.719 | ||
| Theoretical pI: | 9.900 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 50.615 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.493 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.350 | ||
| sheet | 0.160 | ||