Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK480024.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
PYGSSSSYFVQIWEILWNRDCGIFCRICNGSNRGGYGSNHRSSYGRGALSHDCFYCVWRILCQCRQYANNLPLDSHISARCFRAFQGLCINEFSGLQFDHQHSFDVQTGEQVRQSNKAVC FHF* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 12,101.360 | ||
Theoretical pI: | 9.535 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 18.666 | ||
aromaticity | 0.126 | ||
GRAVY | 0.885 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.243 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK480024.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
PMARLHPTLSRFGKFCGIVTVESFAASAMGLTVGAMVPTTEAAMAVGPSLMTVFIVFGGYYVNADNTPIIFRWIPIFLHVVSGLFKGFASMNLVVFNLIISIHLMFKLESR* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,101.360 | ||
Theoretical pI: | 9.535 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 18.666 | ||
aromaticity | 0.126 | ||
GRAVY | 0.885 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.243 | ||
sheet | 0.270 |