Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK480038.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
HTTLRPNLEQSKVDFVKSLPNADTRLVLFEAEIYNPDTFEKAIQGCEYVFHVATAVQHTEGYQFKNIVEACVAAAKKIATFCVQSGTVKRLIYTSSVTCGSPLKEDGSGYKDFMDEPVGL LFTIHLLFRLVI* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,734.766 | ||
Theoretical pI: | 6.077 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 29.580 | ||
aromaticity | 0.106 | ||
GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.174 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK480038.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
HTTLRPNLEQSKVDFVKSLPNADTRLVLFEAEIYNPDTFEKAIQGCEYVFHVATAVQHTEGYQFKNIVEACVAAAKKIATFCVQSGTVKRLIYTSSVTCGSPLKEDGSGYKDFMDEPVGL LFTIHLLFRLVI* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,734.766 | ||
Theoretical pI: | 6.077 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 29.580 | ||
aromaticity | 0.106 | ||
GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.174 | ||
sheet | 0.242 |