| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK480038.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
| HTTLRPNLEQSKVDFVKSLPNADTRLVLFEAEIYNPDTFEKAIQGCEYVFHVATAVQHTEGYQFKNIVEACVAAAKKIATFCVQSGTVKRLIYTSSVTCGSPLKEDGSGYKDFMDEPVGL LFTIHLLFRLVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,734.766 | ||
| Theoretical pI: | 6.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 29.580 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.174 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK480038.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
| HTTLRPNLEQSKVDFVKSLPNADTRLVLFEAEIYNPDTFEKAIQGCEYVFHVATAVQHTEGYQFKNIVEACVAAAKKIATFCVQSGTVKRLIYTSSVTCGSPLKEDGSGYKDFMDEPVGL LFTIHLLFRLVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,734.766 | ||
| Theoretical pI: | 6.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 29.580 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.174 | ||
| sheet | 0.242 | ||