| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK480074.1 | internal | 162 | 3-488(+) |
Amino Acid sequence : | |||
| SRVETISRLAQWRIENFGPCSYQKSNPFKVGIWNWHLSVEKNRYLYIPLFPEPSRLSKEQPPIARFAVRVSNAGTNRRLYISPVHERLLRSCEDFVWYVDSTFHGLFIIDVEFLDLKICP LNGGEANSIWPSDGMMQSISAQSTLRCLSRMLDEGIHADVVI | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 12,169.090 | ||
| Theoretical pI: | 8.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 45.323 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK480074.1 | 5prime_partial | 108 | 1-327(+) |
Amino Acid sequence : | |||
| ILEWKQSQDLLSGELKTSALALTKNPTPLRSVSGTGTCLSRRIVICIYLCFPNHLVYQKNNRLLQDSLFVSLMLEQIADFTSLQFTRDYFGHAKTLSGMLIPPFMVSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,169.090 | ||
| Theoretical pI: | 8.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 45.323 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK480074.1 | internal | 162 | 3-488(+) |
Amino Acid sequence : | |||
| SRVETISRLAQWRIENFGPCSYQKSNPFKVGIWNWHLSVEKNRYLYIPLFPEPSRLSKEQPPIARFAVRVSNAGTNRRLYISPVHERLLRSCEDFVWYVDSTFHGLFIIDVEFLDLKICP LNGGEANSIWPSDGMMQSISAQSTLRCLSRMLDEGIHADVVI | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 12,169.090 | ||
| Theoretical pI: | 8.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 45.323 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK480074.1 | 5prime_partial | 108 | 1-327(+) |
Amino Acid sequence : | |||
| ILEWKQSQDLLSGELKTSALALTKNPTPLRSVSGTGTCLSRRIVICIYLCFPNHLVYQKNNRLLQDSLFVSLMLEQIADFTSLQFTRDYFGHAKTLSGMLIPPFMVSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,169.090 | ||
| Theoretical pI: | 8.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 45.323 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||