Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK492896.1 | internal | 115 | 3-347(+) |
Amino Acid sequence : | |||
LDESVLWSESKDLGDSFRCIRMVNNIRLNFDAFHGDKDHGGVRDGTPVHLYEWFKGDNQRWKIVPYGQELPNELQPTVHPTMRIYSKAAEDYSLTVRNGNVVLAPANRGDVHQHW | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,274.637 | ||
Theoretical pI: | 6.043 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 31.520 | ||
aromaticity | 0.104 | ||
GRAVY | -0.710 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.252 | ||
sheet | 0.191 |