Acc_NO	ORF type	length	start-end position (strand +/-)
>JK492899.1	5prime_partial	132	1-399(+)
Amino Acid sequence :
ACQRGKQTKTAFKSKDFVSTSKPLDLLHLDLFGPVQHTSLVGKRFVLVVVDDYSRYTWTYFLAHKNDTFESLVSLIKILETQRSSKVVCLRSDHGGEFENNEFSSFCDEKGITHQFSAPR TPQQNGVVERKN*
Physicochemical properties
Number of amino acids:		132
Molecular weight:		13,946.209
Theoretical pI:		9.646
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14565
Instability index:		44.104
aromaticity		0.142
GRAVY		-0.040
Secondary Structure Fraction
Helix		0.383
turn		0.217
sheet		0.192

Acc_NO	ORF type	length	start-end position (strand +/-)
>JK492899.1	complete	120	412-774(+)
Amino Acid sequence :
MARTMLNESSLPKYLWAEAVNTVCHVLNRCMVRPILKKTPFELYFGRKPSIFYFKPFGVKCFILNTLDKLSKFDSKVDEGIFVGYSSRSKAYRVFNKRVLTIVESVHVTFDESKQIYSSV *
Physicochemical properties
Number of amino acids:		120
Molecular weight:		13,946.209
Theoretical pI:		9.646
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14565
Instability index:		44.104
aromaticity		0.142
GRAVY		-0.040
Secondary Structure Fraction
Helix		0.383
turn		0.217
sheet		0.192