Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK623991.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
TTDDINDSWVSMTTVADINDKWASYAGPGGWNDPDMLEVGNGGMTYHEYRAHFSIWALMKAPLLVGCDVRNMTAETFEILSNKEVIDINQDPLGVQGRKVYVSGTDDCLQVWAGPLSGHR LVVAFWNRCSKAATITAPWD | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,481.223 | ||
Theoretical pI: | 4.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44585 | ||
Instability index: | 19.019 | ||
aromaticity | 0.100 | ||
GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.243 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK623991.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
TTDDINDSWVSMTTVADINDKWASYAGPGGWNDPDMLEVGNGGMTYHEYRAHFSIWALMKAPLLVGCDVRNMTAETFEILSNKEVIDINQDPLGVQGRKVYVSGTDDCLQVWAGPLSGHR LVVAFWNRCSKAATITAPWD | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,481.223 | ||
Theoretical pI: | 4.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44585 | ||
Instability index: | 19.019 | ||
aromaticity | 0.100 | ||
GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.243 | ||
sheet | 0.221 |