| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624019.1 | internal | 160 | 1-480(+) |
Amino Acid sequence : | |||
| TKFNRAVEGSRKCRKIFVDIIKQRKIDLFEKDRKEANDVLSNILLENHRDGIETKDVVLAKNLVSLLSAAFDNPSVTIVSIIKNLAENPEIYARVRSEQLEIAKGKAPGENLTMEDLKKM KFSMNVLSESLRMEAPASGTFREALNDFTYEGYLIPKGWK | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,175.764 | ||
| Theoretical pI: | 8.923 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 33.161 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.403 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.213 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624019.1 | internal | 160 | 1-480(+) |
Amino Acid sequence : | |||
| TKFNRAVEGSRKCRKIFVDIIKQRKIDLFEKDRKEANDVLSNILLENHRDGIETKDVVLAKNLVSLLSAAFDNPSVTIVSIIKNLAENPEIYARVRSEQLEIAKGKAPGENLTMEDLKKM KFSMNVLSESLRMEAPASGTFREALNDFTYEGYLIPKGWK | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,175.764 | ||
| Theoretical pI: | 8.923 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 33.161 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.403 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.213 | ||
| sheet | 0.294 | ||