Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624023.1 | internal | 192 | 1-576(+) |
Amino Acid sequence : | |||
QQRGKLTVHAEECINSKTTTELILRCSDLEYKDLFARNDPFLVISKIVEGGMPIPVCKTEVLKNELKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKIQKSLVDLEKLHSSG KGENLFLPTAAGSNSQNKLLKSQLFVDKFSESIQYTFLDYLAGGFELNFMVAIDFTASNGNPRLPDSLHYLD | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,501.366 | ||
Theoretical pI: | 6.121 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 31.593 | ||
aromaticity | 0.089 | ||
GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.260 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624023.1 | internal | 192 | 1-576(+) |
Amino Acid sequence : | |||
QQRGKLTVHAEECINSKTTTELILRCSDLEYKDLFARNDPFLVISKIVEGGMPIPVCKTEVLKNELKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKIQKSLVDLEKLHSSG KGENLFLPTAAGSNSQNKLLKSQLFVDKFSESIQYTFLDYLAGGFELNFMVAIDFTASNGNPRLPDSLHYLD | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,501.366 | ||
Theoretical pI: | 6.121 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 31.593 | ||
aromaticity | 0.089 | ||
GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.260 | ||
sheet | 0.240 |