Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624049.1 | 5prime_partial | 176 | 592-62(-) |
Amino Acid sequence : | |||
GKVVFFLFVTVFSFIHYVSCAHHAAAEAPAPAVDCSSLVLNMADCLSFVSAGSTVSKPEASCCSGLKTVLKTDAECLCEAFKSSASLGVTLNVTKALTLPSLCKVSAPPAANCALSLSPA AAPGISPTAGGASPAASSGANEQAPAPAPGVSSSSLLSISVGTVLIGLVVACFSSF* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 13,921.291 | ||
Theoretical pI: | 4.940 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.243 | ||
aromaticity | 0.037 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.250 | ||
sheet | 0.426 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624049.1 | complete | 136 | 117-527(+) |
Amino Acid sequence : | |||
MESKEELETPGAGAGACSFAPELAAGEAPPAVGEMPGAAAGERDKAQLAAGGAETLQREGRVRALVTFKVTPREALLLKASHRHSASVFNTVFNPEQQEASGLETVLPAETNDRQSAMFN TKLEQSTAGAGASAAA* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 13,921.291 | ||
Theoretical pI: | 4.940 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.243 | ||
aromaticity | 0.037 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.250 | ||
sheet | 0.426 |