| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624052.1 | internal | 107 | 3-323(+) |
Amino Acid sequence : | |||
| RFQELSSYRDDHLVCVIEDDCSGKIIATGSMFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAMGCYKVILDCSVDNKGFYEKCGFKQKEIQMAM | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,082.988 | ||
| Theoretical pI: | 7.768 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 30.216 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.159 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624052.1 | internal | 107 | 3-323(+) |
Amino Acid sequence : | |||
| RFQELSSYRDDHLVCVIEDDCSGKIIATGSMFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAMGCYKVILDCSVDNKGFYEKCGFKQKEIQMAM | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,082.988 | ||
| Theoretical pI: | 7.768 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 30.216 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.159 | ||
| sheet | 0.215 | ||