Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624057.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
LIQSGPPRFQEKAEFLLQCLPGTLVVVIKRGNNMKQSVGNPSVYCKLTLGNSPPRQTKVVSTGPNPEWDESFAWTFESPPKGQKLHISCKNKSKMGKSSFGKVTIQIDRVVMLGAVAGEY TLLPESKSGPSRNLEIEFQWSNK* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,807.060 | ||
Theoretical pI: | 9.604 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 51.801 | ||
aromaticity | 0.077 | ||
GRAVY | -0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.329 | ||
sheet | 0.196 |