Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624061.1 | complete | 139 | 61-480(+) |
Amino Acid sequence : | |||
MSGEEVAPAAETAAPLGEAMDLMTALQIVLRKSLAHGGLARGLHEGAKVIEKHAAQLCVLAEDCNQPDYVKLVKALCADHNVSLLTVPSAKTLGEWAGLCKIDSEGKARKVVGCSCVVVK DFGEESDGLNVVQQHIKSH* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,640.755 | ||
Theoretical pI: | 5.831 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 32.063 | ||
aromaticity | 0.022 | ||
GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.194 | ||
sheet | 0.345 |