| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624067.1 | 5prime_partial | 173 | 1-522(+) |
Amino Acid sequence : | |||
| QQRGKLTVHAEECINSKTTTELILRCSDLEYKDLFARNDPFLVISKIVEGGMPIPVCKTEVLKNELKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKIQKSLVDLEKLHSSG KGENLFLPTAAGSNSQNKLLKSQLFVDKFSESIQYTFLDYLAGGFELKFYGGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,401.058 | ||
| Theoretical pI: | 7.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 34.516 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.254 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624067.1 | 5prime_partial | 173 | 1-522(+) |
Amino Acid sequence : | |||
| QQRGKLTVHAEECINSKTTTELILRCSDLEYKDLFARNDPFLVISKIVEGGMPIPVCKTEVLKNELKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKIQKSLVDLEKLHSSG KGENLFLPTAAGSNSQNKLLKSQLFVDKFSESIQYTFLDYLAGGFELKFYGGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,401.058 | ||
| Theoretical pI: | 7.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 34.516 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.254 | ||
| sheet | 0.231 | ||