| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624069.1 | 5prime_partial | 177 | 1-534(+) |
Amino Acid sequence : | |||
| TNLQRFTESMADSRVETISRLAQWRIENFGPCSYKKSDPFKVGIWNWHLSVEKNRYLYIRLFPEPSRLSKEQPPIARFVVRVSNAGTNRRLYISPVHERLLRSCEDFVWYVDSTFHGRFI VDVEFLDLKIYPLNGGEANSIWPSDGMMQSISAQSTLRCLSRMLDEGIHADVCYQHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 13,617.698 | ||
| Theoretical pI: | 9.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 45.136 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.227 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624069.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
| QIYRDSPNQWRILEWKQSQDLLSGELKTSALALTKNPTPLRSVSGTGTCLSRRIVICIYVCFQSHLVYQKNNRLLQDSLFVSLMLEQIADFTSLQFMRDYFGHAKTLSGMLIPPFMVAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,617.698 | ||
| Theoretical pI: | 9.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 45.136 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.227 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624069.1 | 5prime_partial | 177 | 1-534(+) |
Amino Acid sequence : | |||
| TNLQRFTESMADSRVETISRLAQWRIENFGPCSYKKSDPFKVGIWNWHLSVEKNRYLYIRLFPEPSRLSKEQPPIARFVVRVSNAGTNRRLYISPVHERLLRSCEDFVWYVDSTFHGRFI VDVEFLDLKIYPLNGGEANSIWPSDGMMQSISAQSTLRCLSRMLDEGIHADVCYQHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 13,617.698 | ||
| Theoretical pI: | 9.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 45.136 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.227 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624069.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
| QIYRDSPNQWRILEWKQSQDLLSGELKTSALALTKNPTPLRSVSGTGTCLSRRIVICIYVCFQSHLVYQKNNRLLQDSLFVSLMLEQIADFTSLQFMRDYFGHAKTLSGMLIPPFMVAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,617.698 | ||
| Theoretical pI: | 9.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 45.136 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.227 | ||
| sheet | 0.244 | ||