| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624074.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
| EQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMESAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPPERKYSVWIG | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,076.877 | ||
| Theoretical pI: | 5.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 37.260 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.269 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624074.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
| EQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMESAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPPERKYSVWIG | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,076.877 | ||
| Theoretical pI: | 5.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 37.260 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.269 | ||
| sheet | 0.252 | ||