Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624091.1 | 5prime_partial | 106 | 3-323(+) |
Amino Acid sequence : | |||
RSIGMIERVPGMKALAMNTAEDAIVRLTIEIVPGMIVTGMEVAEIDGSPTMGPTFGAMMISRQKAAHLALKPLGLPNALHGTYVGNVHPELILPAADSPEIAMLNL* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,157.125 | ||
Theoretical pI: | 5.475 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 46.051 | ||
aromaticity | 0.019 | ||
GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.255 | ||
sheet | 0.377 |