Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624095.1 | internal | 155 | 2-466(+) |
Amino Acid sequence : | |||
NLKHNRAYTENRWFVFGISYPGALTAWFRLKFPHLTCGSLASSAVVLAVYNFSEFDRQIGESAGPECKAALQETNQLVERRLASNAKAVKSSFGAAELEIEGDFLYFLANAAVTAFQYGN PDKLCTPLVEAKKAGEDLVDAYAKYVKRVFTLGIQ | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,124.266 | ||
Theoretical pI: | 7.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 33.570 | ||
aromaticity | 0.129 | ||
GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.206 | ||
sheet | 0.316 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624095.1 | internal | 155 | 2-466(+) |
Amino Acid sequence : | |||
NLKHNRAYTENRWFVFGISYPGALTAWFRLKFPHLTCGSLASSAVVLAVYNFSEFDRQIGESAGPECKAALQETNQLVERRLASNAKAVKSSFGAAELEIEGDFLYFLANAAVTAFQYGN PDKLCTPLVEAKKAGEDLVDAYAKYVKRVFTLGIQ | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,124.266 | ||
Theoretical pI: | 7.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 33.570 | ||
aromaticity | 0.129 | ||
GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.206 | ||
sheet | 0.316 |