| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624096.1 | internal | 159 | 1-477(+) |
Amino Acid sequence : | |||
| TKFNRAVEGSRKCRKIFVNIIKQRKIDLFEKDRKEANDVLSNILLENHRDGIETKDVVLAKNLVSLLSAAFDNPSVTIVSIIKNLAENPEIYARVRSEQLEIAKGKAPGENLTMEDLKKM KFSMNVLSESLRMEAPASGTFREALNDFTYEGYLIPKGW | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,046.607 | ||
| Theoretical pI: | 8.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 37.016 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.220 | ||
| sheet | 0.296 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624096.1 | internal | 159 | 1-477(+) |
Amino Acid sequence : | |||
| TKFNRAVEGSRKCRKIFVNIIKQRKIDLFEKDRKEANDVLSNILLENHRDGIETKDVVLAKNLVSLLSAAFDNPSVTIVSIIKNLAENPEIYARVRSEQLEIAKGKAPGENLTMEDLKKM KFSMNVLSESLRMEAPASGTFREALNDFTYEGYLIPKGW | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,046.607 | ||
| Theoretical pI: | 8.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 37.016 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.220 | ||
| sheet | 0.296 | ||