| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624099.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
| TLPDMFPALGFIPILSGKKAFLQNIQKEADKILDYIIDEHIQRTKSKDYDGKESDKEDIVDVLLRLEKTGELEIPITTQDIKAVIWSVFAGGTDTSSTTTLWAMSELMRNPKVMEKVQAE VR | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,798.714 | ||
| Theoretical pI: | 4.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 32.399 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.302 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.164 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624099.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
| TLPDMFPALGFIPILSGKKAFLQNIQKEADKILDYIIDEHIQRTKSKDYDGKESDKEDIVDVLLRLEKTGELEIPITTQDIKAVIWSVFAGGTDTSSTTTLWAMSELMRNPKVMEKVQAE VR | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,798.714 | ||
| Theoretical pI: | 4.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 32.399 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.302 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.164 | ||
| sheet | 0.262 | ||