| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624104.1 | internal | 156 | 2-469(+) |
Amino Acid sequence : | |||
| RACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRADYIKIFVLDEADEMLSRGFKDQIYDIFQLLPPKIQIGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVN VEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWL | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 18,079.873 | ||
| Theoretical pI: | 7.940 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 46.483 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.106 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.154 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624104.1 | internal | 156 | 2-469(+) |
Amino Acid sequence : | |||
| RACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRADYIKIFVLDEADEMLSRGFKDQIYDIFQLLPPKIQIGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVN VEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWL | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 18,079.873 | ||
| Theoretical pI: | 7.940 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 46.483 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.106 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.154 | ||
| sheet | 0.244 | ||