Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624130.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
LSSKQALFDLAVFRQHYQESLNLKHNRADTENRWFVFGISYPGALSAWFRLKFPHSTCGSLASSAVVLAVYNFSEFDRQIGESAGPECKAALQETNQLVERRLASNAKAVKSSFGAAELE IEGDFLYFLADAAVTAFQYGNPDKLCTPLVE | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,733.617 | ||
Theoretical pI: | 5.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 40.276 | ||
aromaticity | 0.126 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.225 | ||
sheet | 0.318 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK624130.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
LSSKQALFDLAVFRQHYQESLNLKHNRADTENRWFVFGISYPGALSAWFRLKFPHSTCGSLASSAVVLAVYNFSEFDRQIGESAGPECKAALQETNQLVERRLASNAKAVKSSFGAAELE IEGDFLYFLADAAVTAFQYGNPDKLCTPLVE | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,733.617 | ||
Theoretical pI: | 5.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 40.276 | ||
aromaticity | 0.126 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.225 | ||
sheet | 0.318 |