| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624146.1 | 5prime_partial | 114 | 386-42(-) |
Amino Acid sequence : | |||
| FFFNKKGRPQPKLPPLTNFFPPRIGPVEAGLGFQKRGGSAPAFRFTEKSKNNVKSSGISLSPFPAPTYTTPLKSFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESR* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,308.853 | ||
| Theoretical pI: | 10.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 60.888 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.504 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.395 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624146.1 | 5prime_partial | 114 | 386-42(-) |
Amino Acid sequence : | |||
| FFFNKKGRPQPKLPPLTNFFPPRIGPVEAGLGFQKRGGSAPAFRFTEKSKNNVKSSGISLSPFPAPTYTTPLKSFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESR* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,308.853 | ||
| Theoretical pI: | 10.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 60.888 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.504 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.395 | ||
| sheet | 0.167 | ||