| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624150.1 | internal | 174 | 2-523(+) |
Amino Acid sequence : | |||
| PHATDITTELVVLRLMSHPEVFKTARDEIHNPVGQSRLIDDADLAKLPYLYSIIYETLRLRSVSVLPPRESSMECTIGGYRIPAGTQLLVNSGAAHMDPELWNDPEMFKPERFQHNEEKK VACKFLPFGLGRKQCPGAGLAMRLIALLLGTLIQCFEWEKADEVPVNIIFQPHE | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,649.528 | ||
| Theoretical pI: | 5.701 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 48.976 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.213 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK624150.1 | internal | 174 | 2-523(+) |
Amino Acid sequence : | |||
| PHATDITTELVVLRLMSHPEVFKTARDEIHNPVGQSRLIDDADLAKLPYLYSIIYETLRLRSVSVLPPRESSMECTIGGYRIPAGTQLLVNSGAAHMDPELWNDPEMFKPERFQHNEEKK VACKFLPFGLGRKQCPGAGLAMRLIALLLGTLIQCFEWEKADEVPVNIIFQPHE | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,649.528 | ||
| Theoretical pI: | 5.701 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 48.976 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.213 | ||
| sheet | 0.305 | ||