| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK998956.1 | 5prime_partial | 101 | 510-205(-) |
Amino Acid sequence : | |||
| QPNSPPDNAFRPDRPVEAGLGSKKRGSAPLPIHGISKITLKVVVFHFRRFRLPLILHLSSEFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESR* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,023.458 | ||
| Theoretical pI: | 10.566 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.785 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.347 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK998956.1 | 5prime_partial | 101 | 510-205(-) |
Amino Acid sequence : | |||
| QPNSPPDNAFRPDRPVEAGLGSKKRGSAPLPIHGISKITLKVVVFHFRRFRLPLILHLSSEFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESR* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,023.458 | ||
| Theoretical pI: | 10.566 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.785 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.347 | ||
| sheet | 0.198 | ||