| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK998981.1 | 5prime_partial | 206 | 1-621(+) |
Amino Acid sequence : | |||
| LKACVKAKTVKRVILTSSAAAVSINKQDGTGLVIDENSWTDVEFLSSEKPPTWGYPASKTLAEKAAWKFAQQNNIDLITVIPTLMAGPSLTPDIPSSTGFAMCLLTGNEFLINGMKGMQM LSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVNTSVPELAKILNKRYPEYKVPTDFGDFPSETKLILSSKKLISEGFNFQVWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 22,454.670 | ||
| Theoretical pI: | 6.916 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 34.493 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.252 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK998981.1 | 5prime_partial | 206 | 1-621(+) |
Amino Acid sequence : | |||
| LKACVKAKTVKRVILTSSAAAVSINKQDGTGLVIDENSWTDVEFLSSEKPPTWGYPASKTLAEKAAWKFAQQNNIDLITVIPTLMAGPSLTPDIPSSTGFAMCLLTGNEFLINGMKGMQM LSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVNTSVPELAKILNKRYPEYKVPTDFGDFPSETKLILSSKKLISEGFNFQVWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 22,454.670 | ||
| Theoretical pI: | 6.916 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 34.493 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.252 | ||
| sheet | 0.257 | ||