Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK998981.1 | 5prime_partial | 206 | 1-621(+) |
Amino Acid sequence : | |||
LKACVKAKTVKRVILTSSAAAVSINKQDGTGLVIDENSWTDVEFLSSEKPPTWGYPASKTLAEKAAWKFAQQNNIDLITVIPTLMAGPSLTPDIPSSTGFAMCLLTGNEFLINGMKGMQM LSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVNTSVPELAKILNKRYPEYKVPTDFGDFPSETKLILSSKKLISEGFNFQVWD* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 22,454.670 | ||
Theoretical pI: | 6.916 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
Instability index: | 34.493 | ||
aromaticity | 0.083 | ||
GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.252 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK998981.1 | 5prime_partial | 206 | 1-621(+) |
Amino Acid sequence : | |||
LKACVKAKTVKRVILTSSAAAVSINKQDGTGLVIDENSWTDVEFLSSEKPPTWGYPASKTLAEKAAWKFAQQNNIDLITVIPTLMAGPSLTPDIPSSTGFAMCLLTGNEFLINGMKGMQM LSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVNTSVPELAKILNKRYPEYKVPTDFGDFPSETKLILSSKKLISEGFNFQVWD* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 22,454.670 | ||
Theoretical pI: | 6.916 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
Instability index: | 34.493 | ||
aromaticity | 0.083 | ||
GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.252 | ||
sheet | 0.257 |