Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK998984.1 | 5prime_partial | 159 | 2-481(+) |
Amino Acid sequence : | |||
LSIMKACTDAKTVRRLVFTSSAGTVDVEEHRKPVYDESCWSDLEFVQAVKMTGWMYFVSKTLAEKAAWKFAEENNIDFISIIPTLVFGPFLMPSMPPSLITALSPITRNEDHYQIIKQGS LCIYMIYAMRIYICMSILKRMGDTSVLHTHPPFLNLPNC* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 18,120.100 | ||
Theoretical pI: | 7.055 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
Instability index: | 67.244 | ||
aromaticity | 0.107 | ||
GRAVY | 0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.208 | ||
sheet | 0.252 |