| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK998997.1 | 5prime_partial | 157 | 3-476(+) |
Amino Acid sequence : | |||
| LLNEFSLRLKRLYNLGARKFLVINIPAAGCIPSYAIKTKPKCNMEINDGFKFYNNKLTGMLQQLQSELPGSAFALSDTYKFLLELKERGQKYGINDTSNPCCPENYDGKSHCLPFTVPCK RRETHLFFDEGHPTQIVNDIFVRKCFNQLSICSPLPN* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,914.561 | ||
| Theoretical pI: | 8.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9440 | ||
| Instability index: | 42.773 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.268 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK998997.1 | 5prime_partial | 157 | 3-476(+) |
Amino Acid sequence : | |||
| LLNEFSLRLKRLYNLGARKFLVINIPAAGCIPSYAIKTKPKCNMEINDGFKFYNNKLTGMLQQLQSELPGSAFALSDTYKFLLELKERGQKYGINDTSNPCCPENYDGKSHCLPFTVPCK RRETHLFFDEGHPTQIVNDIFVRKCFNQLSICSPLPN* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,914.561 | ||
| Theoretical pI: | 8.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9440 | ||
| Instability index: | 42.773 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.268 | ||
| sheet | 0.223 | ||