| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999001.1 | complete | 157 | 132-605(+) |
Amino Acid sequence : | |||
| MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAP LPIHGISKITLKVVVFHFRRFRLPLILHLSSHFTKSD* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,607.039 | ||
| Theoretical pI: | 10.220 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 47.373 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.306 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999001.1 | complete | 157 | 132-605(+) |
Amino Acid sequence : | |||
| MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAP LPIHGISKITLKVVVFHFRRFRLPLILHLSSHFTKSD* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,607.039 | ||
| Theoretical pI: | 10.220 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 47.373 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.306 | ||
| sheet | 0.178 | ||