Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999017.1 | complete | 157 | 132-605(+) |
Amino Acid sequence : | |||
MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAP LPIHGISKITLKVVVFHFRRFRLPLILHLSSHFTKSD* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,607.039 | ||
Theoretical pI: | 10.220 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 47.373 | ||
aromaticity | 0.096 | ||
GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.306 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999017.1 | complete | 157 | 132-605(+) |
Amino Acid sequence : | |||
MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAP LPIHGISKITLKVVVFHFRRFRLPLILHLSSHFTKSD* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,607.039 | ||
Theoretical pI: | 10.220 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 47.373 | ||
aromaticity | 0.096 | ||
GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.306 | ||
sheet | 0.178 |