Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999018.1 | 5prime_partial | 103 | 416-105(-) |
Amino Acid sequence : | |||
TENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAPLPIHGISKITLKVVVFHFRRFRLPLILHLSSHFTKSD* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,673.362 | ||
Theoretical pI: | 9.863 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 52.451 | ||
aromaticity | 0.087 | ||
GRAVY | -0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.291 | ||
sheet | 0.184 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999018.1 | 5prime_partial | 103 | 416-105(-) |
Amino Acid sequence : | |||
TENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAPLPIHGISKITLKVVVFHFRRFRLPLILHLSSHFTKSD* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,673.362 | ||
Theoretical pI: | 9.863 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 52.451 | ||
aromaticity | 0.087 | ||
GRAVY | -0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.291 | ||
sheet | 0.184 |