| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999021.1 | internal | 114 | 3-344(+) |
Amino Acid sequence : | |||
| VDAYDYFDSNAEYVEFHRLQEEDHHKLIYNGSEVTEEFQETEYYKDLNCVDKHHHTTGTGFIIMETANVKCFNLSPDATNTCHSSCKGNPATNDWIPSADNMETFSSDNPNTSD | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 13,035.783 | ||
| Theoretical pI: | 4.449 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 36.019 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.920 | ||
Secondary Structure Fraction | |||
| Helix | 0.228 | ||
| turn | 0.246 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999021.1 | internal | 114 | 3-344(+) |
Amino Acid sequence : | |||
| VDAYDYFDSNAEYVEFHRLQEEDHHKLIYNGSEVTEEFQETEYYKDLNCVDKHHHTTGTGFIIMETANVKCFNLSPDATNTCHSSCKGNPATNDWIPSADNMETFSSDNPNTSD | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 13,035.783 | ||
| Theoretical pI: | 4.449 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 36.019 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.920 | ||
Secondary Structure Fraction | |||
| Helix | 0.228 | ||
| turn | 0.246 | ||
| sheet | 0.202 | ||