| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999022.1 | 5prime_partial | 207 | 629-6(-) |
Amino Acid sequence : | |||
| LKIKGICQFWPKSPSDYTEATSEYARQLRGLATKILSVLSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDISALTFILHNMVPGLQLLYQGKWVTAKCVPNSII MHIGDTIEILSNGKYKSILHRGLVNKEKVRISWAVFCEPLKEKIILKPLPETISEKEPALFPPRTFQQHIEHKLFRKTQDALLSKED* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,458.243 | ||
| Theoretical pI: | 8.589 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 49.354 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.208 | ||
| sheet | 0.300 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999022.1 | 5prime_partial | 207 | 629-6(-) |
Amino Acid sequence : | |||
| LKIKGICQFWPKSPSDYTEATSEYARQLRGLATKILSVLSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDISALTFILHNMVPGLQLLYQGKWVTAKCVPNSII MHIGDTIEILSNGKYKSILHRGLVNKEKVRISWAVFCEPLKEKIILKPLPETISEKEPALFPPRTFQQHIEHKLFRKTQDALLSKED* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,458.243 | ||
| Theoretical pI: | 8.589 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 49.354 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.208 | ||
| sheet | 0.300 | ||