Acc_NO	ORF type	length	start-end position (strand +/-)
>JK999039.1	internal	183	2-550(+)
Amino Acid sequence :
IAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGAKNYELLGGGANVVNHGYTKGDGLGAEIVGTFVLVYTVFSATDAKRNARDSHVP ILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWDDHWIFWVGPFIGATLAAV
Physicochemical properties
Number of amino acids:		183
Molecular weight:		12,687.225
Theoretical pI:		7.733
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22250
Instability index:		53.168
aromaticity		0.061
GRAVY		0.749
Secondary Structure Fraction
Helix		0.386
turn		0.228
sheet		0.421

Acc_NO	ORF type	length	start-end position (strand +/-)
>JK999039.1	5prime_partial	150	550-98(-)
Amino Acid sequence :
HSSKCSSNEWTNPEDPVVIPGMVFVEDDSSSKTPSRVDTSSRNGDCSQVHQEHCKPNWKWSQNRDMRVSSISLGISSREDSVDKNEGANNLSTKAIALGVAMINNVGTATQQFIVLRTFK SLDNTSTTDGSEALHNHVEKSPCKGKFSCQ*
Physicochemical properties
Number of amino acids:		150
Molecular weight:		12,687.225
Theoretical pI:		7.733
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22250
Instability index:		53.168
aromaticity		0.061
GRAVY		0.749
Secondary Structure Fraction
Helix		0.386
turn		0.228
sheet		0.421

Acc_NO	ORF type	length	start-end position (strand +/-)
>JK999039.1	3prime_partial	114	210-551(+)
Amino Acid sequence :
MNCWVAVPTLLIMATPRAMALVLRLLAPSFLSTLSSLLLMPREMLETLMSLFWLHFQLGLQCSWCTWLQSPLRELVSTRLGVLELLSSSTKTMPGMTTGSSGLVHSLELHLLLC
Physicochemical properties
Number of amino acids:		114
Molecular weight:		12,687.225
Theoretical pI:		7.733
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22250
Instability index:		53.168
aromaticity		0.061
GRAVY		0.749
Secondary Structure Fraction
Helix		0.386
turn		0.228
sheet		0.421

Acc_NO	ORF type	length	start-end position (strand +/-)
>JK999039.1	internal	183	2-550(+)
Amino Acid sequence :
IAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGAKNYELLGGGANVVNHGYTKGDGLGAEIVGTFVLVYTVFSATDAKRNARDSHVP ILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWDDHWIFWVGPFIGATLAAV
Physicochemical properties
Number of amino acids:		183
Molecular weight:		12,687.225
Theoretical pI:		7.733
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22250
Instability index:		53.168
aromaticity		0.061
GRAVY		0.749
Secondary Structure Fraction
Helix		0.386
turn		0.228
sheet		0.421

Acc_NO	ORF type	length	start-end position (strand +/-)
>JK999039.1	5prime_partial	150	550-98(-)
Amino Acid sequence :
HSSKCSSNEWTNPEDPVVIPGMVFVEDDSSSKTPSRVDTSSRNGDCSQVHQEHCKPNWKWSQNRDMRVSSISLGISSREDSVDKNEGANNLSTKAIALGVAMINNVGTATQQFIVLRTFK SLDNTSTTDGSEALHNHVEKSPCKGKFSCQ*
Physicochemical properties
Number of amino acids:		150
Molecular weight:		12,687.225
Theoretical pI:		7.733
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22250
Instability index:		53.168
aromaticity		0.061
GRAVY		0.749
Secondary Structure Fraction
Helix		0.386
turn		0.228
sheet		0.421

Acc_NO	ORF type	length	start-end position (strand +/-)
>JK999039.1	3prime_partial	114	210-551(+)
Amino Acid sequence :
MNCWVAVPTLLIMATPRAMALVLRLLAPSFLSTLSSLLLMPREMLETLMSLFWLHFQLGLQCSWCTWLQSPLRELVSTRLGVLELLSSSTKTMPGMTTGSSGLVHSLELHLLLC
Physicochemical properties
Number of amino acids:		114
Molecular weight:		12,687.225
Theoretical pI:		7.733
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22250
Instability index:		53.168
aromaticity		0.061
GRAVY		0.749
Secondary Structure Fraction
Helix		0.386
turn		0.228
sheet		0.421