| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999050.1 | 3prime_partial | 141 | 132-554(+) |
Amino Acid sequence : | |||
| MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAP LPIHGISKITLKVVVFHFRRF | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,760.902 | ||
| Theoretical pI: | 10.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 48.252 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.312 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999050.1 | 3prime_partial | 141 | 132-554(+) |
Amino Acid sequence : | |||
| MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVEAGLGSKKRGSAP LPIHGISKITLKVVVFHFRRF | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,760.902 | ||
| Theoretical pI: | 10.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 48.252 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.312 | ||
| sheet | 0.170 | ||