Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999078.1 | 5prime_partial | 196 | 2-592(+) |
Amino Acid sequence : | |||
LSIMKACRDAKTVRRLVFTSSAGTVDVEEHRKPVYDESCWSDLEFVQAVKMTGWMYFVSKTLAEKAAWKFAEENNIDFISIIPTLVVGPFLMPSMPPSLITALSPITRNEDHYQIIKQGQ FGHFYDLCNAHIYLYEHPEANGRYICSSHAATILEVAKLLREKYPEFNVPTEFKGVDEKHQKMSYSLSKKADRLGI* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 22,414.538 | ||
Theoretical pI: | 6.721 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
Instability index: | 52.925 | ||
aromaticity | 0.112 | ||
GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.199 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999078.1 | 5prime_partial | 196 | 2-592(+) |
Amino Acid sequence : | |||
LSIMKACRDAKTVRRLVFTSSAGTVDVEEHRKPVYDESCWSDLEFVQAVKMTGWMYFVSKTLAEKAAWKFAEENNIDFISIIPTLVVGPFLMPSMPPSLITALSPITRNEDHYQIIKQGQ FGHFYDLCNAHIYLYEHPEANGRYICSSHAATILEVAKLLREKYPEFNVPTEFKGVDEKHQKMSYSLSKKADRLGI* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 22,414.538 | ||
Theoretical pI: | 6.721 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
Instability index: | 52.925 | ||
aromaticity | 0.112 | ||
GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.199 | ||
sheet | 0.260 |