| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999083.1 | 5prime_partial | 189 | 3-572(+) |
Amino Acid sequence : | |||
| EDKRDMSIWPKSPSDYTEATSEYARQLRGLATKILSVLSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDISALTFILHNMVPGLQLLYQGKWVTAKCVPNSIIM HIGDTIEILSNGKYKSILHRGLVNKEKVRISWAVFCEPLKEKIILKPLPETISEKEPALFPPRTFSTAH* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 21,251.570 | ||
| Theoretical pI: | 7.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 52.603 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.228 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999083.1 | 5prime_partial | 189 | 3-572(+) |
Amino Acid sequence : | |||
| EDKRDMSIWPKSPSDYTEATSEYARQLRGLATKILSVLSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDISALTFILHNMVPGLQLLYQGKWVTAKCVPNSIIM HIGDTIEILSNGKYKSILHRGLVNKEKVRISWAVFCEPLKEKIILKPLPETISEKEPALFPPRTFSTAH* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 21,251.570 | ||
| Theoretical pI: | 7.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 52.603 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.228 | ||
| sheet | 0.307 | ||