Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999114.1 | 5prime_partial | 213 | 1-642(+) |
Amino Acid sequence : | |||
LKMILPIFILSLLFSSSSSSYAAVQDFCVGDLSAPEGPSGYSCKKPAKVTVNDFVFSGLGAAGNTSNLIKAAVTPAFAAQFPGLNGLGVSVTRLDLAPGGVVPMHTHPGASEVLIVIQGS ICAGFISSANAVYFTSLKKGDTMVFPQGLLHFQVNAGGSPALAFVSFSSPSPGLQILDFALFGNNLPSELVEQTTFLDDAQVKKLKGVLGGSG* | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 21,828.864 | ||
Theoretical pI: | 6.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 39.350 | ||
aromaticity | 0.089 | ||
GRAVY | 0.459 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.333 | ||
sheet | 0.249 |