| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999141.1 | 5prime_partial | 249 | 1-750(+) |
Amino Acid sequence : | |||
| TNGLRIEKFNIVQTGIHHAMDPNPYRGDFGSDGKKYAEDVQNIIDYATSGQVAGFIGEEIQGVGGVVPVAPGYLPAAYKSVREAGGLCIADEAITGFGRTGSHFWAFENQGVIPDIVTMA KGIGNGSPLSAVVTTPEIAKVLGRSTYYSTFAGNEISTTAGLATLNVIEKEGLQKNAHDVGSYLIEKLTALKQKYPIIGDVRGRGLMIGVELVEDRKLKTPVSKKVSAEIHEQLKTWDYW RGKLDCMQM* | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 26,878.299 | ||
| Theoretical pI: | 6.212 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 27.132 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.249 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999141.1 | 5prime_partial | 249 | 1-750(+) |
Amino Acid sequence : | |||
| TNGLRIEKFNIVQTGIHHAMDPNPYRGDFGSDGKKYAEDVQNIIDYATSGQVAGFIGEEIQGVGGVVPVAPGYLPAAYKSVREAGGLCIADEAITGFGRTGSHFWAFENQGVIPDIVTMA KGIGNGSPLSAVVTTPEIAKVLGRSTYYSTFAGNEISTTAGLATLNVIEKEGLQKNAHDVGSYLIEKLTALKQKYPIIGDVRGRGLMIGVELVEDRKLKTPVSKKVSAEIHEQLKTWDYW RGKLDCMQM* | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 26,878.299 | ||
| Theoretical pI: | 6.212 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 27.132 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.249 | ||
| sheet | 0.229 | ||