| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999160.1 | 3prime_partial | 114 | 3-344(+) |
Amino Acid sequence : | |||
| MCLLTGNEFLINGMKGMQMLSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVNTSVPELAKILNKRYPEYKVPTDFGDFPSETKLILSSKKLISEGFNFKFGIEEIYDQTVE | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,747.611 | ||
| Theoretical pI: | 5.406 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 38.135 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.237 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999160.1 | 3prime_partial | 114 | 3-344(+) |
Amino Acid sequence : | |||
| MCLLTGNEFLINGMKGMQMLSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVNTSVPELAKILNKRYPEYKVPTDFGDFPSETKLILSSKKLISEGFNFKFGIEEIYDQTVE | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,747.611 | ||
| Theoretical pI: | 5.406 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 38.135 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.237 | ||
| sheet | 0.272 | ||