Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999166.1 | internal | 197 | 1-591(+) |
Amino Acid sequence : | |||
RFAIRSMADSATSPFKKIQIQRDDTTLDAYVVGKDDAPGIVVLQEWWGVDFEIKNHAIKISQLNPGFKALIPDLYRGKVGLDVAEVQHLMDGLDWQGAIKDIRASAIWLKANGSKKVGVT GYCMGGALTIASSVLVPEVDAVVAFYGIPSSELADPGQAKAPIQAHFGELDNFVGFSDVTAAKALEEKLRVSGIPHE | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 21,221.010 | ||
Theoretical pI: | 5.387 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 13.824 | ||
aromaticity | 0.081 | ||
GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.218 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999166.1 | internal | 197 | 1-591(+) |
Amino Acid sequence : | |||
RFAIRSMADSATSPFKKIQIQRDDTTLDAYVVGKDDAPGIVVLQEWWGVDFEIKNHAIKISQLNPGFKALIPDLYRGKVGLDVAEVQHLMDGLDWQGAIKDIRASAIWLKANGSKKVGVT GYCMGGALTIASSVLVPEVDAVVAFYGIPSSELADPGQAKAPIQAHFGELDNFVGFSDVTAAKALEEKLRVSGIPHE | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 21,221.010 | ||
Theoretical pI: | 5.387 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 13.824 | ||
aromaticity | 0.081 | ||
GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.218 | ||
sheet | 0.254 |