| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999184.1 | internal | 168 | 1-504(+) |
Amino Acid sequence : | |||
| RPRSTWGYPASKTLAEKAAWKFAQQNNIDLITVIPTLMAGPSLTPDIPSSTGFAMCLLTGNEFLINGMKGMQMLSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVNTSVPELAKILN KRYPEYKVPTDFGDFPSETKLILSSKKLISEGFNFKFGIEEIYDQTVE | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,547.180 | ||
| Theoretical pI: | 6.190 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 38.907 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.256 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999184.1 | internal | 168 | 1-504(+) |
Amino Acid sequence : | |||
| RPRSTWGYPASKTLAEKAAWKFAQQNNIDLITVIPTLMAGPSLTPDIPSSTGFAMCLLTGNEFLINGMKGMQMLSGSISIAHVEDVCRAHIFLAEKESASGRYICCAVNTSVPELAKILN KRYPEYKVPTDFGDFPSETKLILSSKKLISEGFNFKFGIEEIYDQTVE | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,547.180 | ||
| Theoretical pI: | 6.190 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 38.907 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.256 | ||
| sheet | 0.262 | ||