Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999186.1 | complete | 144 | 440-6(-) |
Amino Acid sequence : | |||
MKINYYPKCPQPELALGVEAHTDISALNFILHNMVPGLQLLYQGKWVTAKCVPNSIIKHIGDTIEIMSNGKYKSILHRGLVNKEKVRISWAVFCEPLKEKIILKPLPETISEKEPALFPP RTFQQHIEHKLFRKTQDALLSKED* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,527.273 | ||
Theoretical pI: | 9.116 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 47.801 | ||
aromaticity | 0.076 | ||
GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.208 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999186.1 | complete | 144 | 440-6(-) |
Amino Acid sequence : | |||
MKINYYPKCPQPELALGVEAHTDISALNFILHNMVPGLQLLYQGKWVTAKCVPNSIIKHIGDTIEIMSNGKYKSILHRGLVNKEKVRISWAVFCEPLKEKIILKPLPETISEKEPALFPP RTFQQHIEHKLFRKTQDALLSKED* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,527.273 | ||
Theoretical pI: | 9.116 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 47.801 | ||
aromaticity | 0.076 | ||
GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.208 | ||
sheet | 0.257 |