Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999193.1 | 5prime_partial | 166 | 3-503(+) |
Amino Acid sequence : | |||
IVTMAKGIGNGSPLSAVVTTPEIAKVLGRSTYYSTFAGNEISTTAGLATLNVIEKEGLQKNAHDVGSYLIEKLTALKQKYPIIGDVRGRGLMIGVELVEDRKLKTPVSKKVSAEIHEQLK DLGLLAGKAGLYANVIRLLPPLCFNKEDADFVAGALDYTLWKISNN* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 17,842.495 | ||
Theoretical pI: | 8.912 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 29.824 | ||
aromaticity | 0.060 | ||
GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.235 | ||
sheet | 0.289 |