Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK999206.1 | complete | 136 | 28-438(+) |
Amino Acid sequence : | |||
MAGKGGKGLLAAKTTAANKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRISANGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG VIPHIHKSLINKTTKD* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,552.755 | ||
Theoretical pI: | 10.387 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 34.648 | ||
aromaticity | 0.022 | ||
GRAVY | -0.351 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.221 | ||
sheet | 0.265 |