| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999230.1 | internal | 209 | 627-1(-) |
Amino Acid sequence : | |||
| RAIIPAANGHCSARALARYYAALADGGVVPPPHSHLSKPPLGSHPHIPKFPSLEASKKPKGNKSKESIAASKKKTNNYQQIPKHSKDLEAGSHDRNSGNDSYTRLINIENGGSSTSITKN ISNSVEKQSNNTVRKLFGNPRIHDGFLGAGDYANLVLPNGKFGLGFKRYNTEDGSFIGFGHSGMGGSTGFCDMKNRFAIAVTVNKMSLG | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 22,304.828 | ||
| Theoretical pI: | 9.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 36.985 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.616 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.373 | ||
| sheet | 0.187 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999230.1 | internal | 209 | 627-1(-) |
Amino Acid sequence : | |||
| RAIIPAANGHCSARALARYYAALADGGVVPPPHSHLSKPPLGSHPHIPKFPSLEASKKPKGNKSKESIAASKKKTNNYQQIPKHSKDLEAGSHDRNSGNDSYTRLINIENGGSSTSITKN ISNSVEKQSNNTVRKLFGNPRIHDGFLGAGDYANLVLPNGKFGLGFKRYNTEDGSFIGFGHSGMGGSTGFCDMKNRFAIAVTVNKMSLG | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 22,304.828 | ||
| Theoretical pI: | 9.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 36.985 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.616 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.373 | ||
| sheet | 0.187 | ||