| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999252.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
| TNGLRIEKFNIVQTGIHHAMDPNPYRGDFGSDGKKYAEDVQNIIDYATSGQVAGFIGEEIQGVGGVVPVAPGYLPAAYKSVREAGGLCIADEAITGFGRTGSHFWAFENQGVIPDIVTMA KGIGNGSPLSAVVTTPEIAKVLGRSTYYSTFAGNEISTTAGLATLNVIEKEGLQKNAHDVGSYLIEKLTALKQKYPIIGDVRGRGLMIGVELVEDRKLKTPVSKTYLLKYMSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 24,887.042 | ||
| Theoretical pI: | 6.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 21890 | ||
| Instability index: | 32.196 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.266 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK999252.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
| TNGLRIEKFNIVQTGIHHAMDPNPYRGDFGSDGKKYAEDVQNIIDYATSGQVAGFIGEEIQGVGGVVPVAPGYLPAAYKSVREAGGLCIADEAITGFGRTGSHFWAFENQGVIPDIVTMA KGIGNGSPLSAVVTTPEIAKVLGRSTYYSTFAGNEISTTAGLATLNVIEKEGLQKNAHDVGSYLIEKLTALKQKYPIIGDVRGRGLMIGVELVEDRKLKTPVSKTYLLKYMSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 24,887.042 | ||
| Theoretical pI: | 6.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 21890 | ||
| Instability index: | 32.196 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.266 | ||
| sheet | 0.227 | ||